De presentatie wordt gedownload. Even geduld aub

De presentatie wordt gedownload. Even geduld aub

Homology Modeling in de praktijk. Voor de medicus/bioloog…. of zelfs…. 4 niveau’s voor visualisatie…. MSASTQTNEFLSPEVFQHIWDFLEQPICSVQ PIDLNFVDEPSEDGATNKIEISMDCIRMQDS.

Verwante presentaties


Presentatie over: "Homology Modeling in de praktijk. Voor de medicus/bioloog…. of zelfs…. 4 niveau’s voor visualisatie…. MSASTQTNEFLSPEVFQHIWDFLEQPICSVQ PIDLNFVDEPSEDGATNKIEISMDCIRMQDS."— Transcript van de presentatie:

1 Homology Modeling in de praktijk

2 Voor de medicus/bioloog…. of zelfs…. 4 niveau’s voor visualisatie…. MSASTQTNEFLSPEVFQHIWDFLEQPICSVQ PIDLNFVDEPSEDGATNKIEISMDCIRMQDS DLSDMWPQYTNLGLLNSMDQQIQNGSSSTSP YNTDHAQNSVTAPSPYAQPSSTFDALSPSPA IPSNTDYPGPHSFDVSFQQSSTAKSATWTYS TELKKLYCQIAKTCPIQIKVMTPPPQGAVIR AMPVYKKAEHVTEVVKRCPNHELSREFNEGQ IAPPSHLIRVEGNSHAQYVEDPITGRQSVLV PYEPPQVGTEFTTVLYNFMCNSSCVGGMNRR PILIIVTLETRDGQVLGRRCFEARICACPGR DRKADEDSIRKQQVSDSTKNGDGTKRPFRQN THGIQMTSIKKRRSPDDELLYLPVRGRETYE MLLKIKESLELMQYLPQHTIETYRRVIDAVR FTLRQTISFPPRDEWNDFNFDMDARRNKQQR IKEEGE PrimairSecundair Tertiair Quaternair

3 Soms is er meer detail nodig…….. MAEKGDCIASVYGYDLGGRFVDFQ PLGFGVNGLVLSAVDSRACRKVAV KKIALSDARSMKHALREIKIIRRL DHDNIVKVYEVLGPKGTDLQGELF KFSVAYIVQEYMETDLARLLEQGT LAEEHAKLFMYQLLRGLKYIHSAN VLHRDLPANIFISTEDLVLKIGDF GLARIVDQHYSHKGYLSEGLVTKW YRSPRLLLSPNNYTKAIDMWAAGC ILAEMLTGRMLFAGAHELEQMQLL ETIPVIREEDKDELLRVMPSFVSS TWEVKRPLRKLLPEVN ? Protein complex 3D structure -Structuur van het eiwit -Visualisatieprogramma -Kennis

4 MSASTQTNEFLSPEVFQHIWDFLEQPICSVQP IDLNFVDEPSEDGATNKIEISMDCIRMQDSDL SDMWPQYTNLGLLNSMDQQIQNGSSSTSPYNT DHAQNSVTAPSPYAQPSSTFDALSPSPAIPSN TDYPGPHSFDVSFQQSSTAKSATWTYSTELKK LYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYK KAEHVTEVVKRCPNHELSREFNEGQIAPPSHL IRVEGNSHAQYVEDPITGRQSVLVPYEPPQVG TEFTTVLYNFMCNSSCVGGMNRRPILIIVTLE TRDGQVLGRRCFEARICACPGRDRKADEDSIR KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKK RRSPDDELLYLPVRGRETYEMLLKIKESLELM QYLPQHTIETYRRVIDAVRFTLRQTISFPPRD EWNDFNFDMDARRNKQQRIKEEGE BLAST tegen PDB SPAIPSNTDYPGPHSFDVSFQQSSTAKSATW SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTC GAVIRAMPVYKKAEHVTEVVKRCPNHELSRE GTRVRAMAIYKQSQHMTEVVRRCPHHERCSD Sequentie: Structuur: Bekende structuur MSASTQTNEFLSPEVFQHIWDFLEQPICSVQP IDLNFVDEPSEDGATNKIEISMDCIRMQDSDL SDMWPQYTNLGLLNSMDQQIQNGSSSTSPYNT DHAQNSVTAPSPYAQPSSTFDALSPSPAIPSN TDYPGPHSFDVSFQQSSTAKSATWTYSTELKK LYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYK KAEHVTEVVKRCPNHELSREFNEGQIAPPSHL IRVEGNSHAQYVEDPITGRQSVLVPYEPPQVG TEFTTVLYNFMCNSSCVGGMNRRPILIIVTLE TRDGQVLGRRCFEARICACPGRDRKADEDSIR KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKK RRSPDDELLYLPVRGRETYEMLLKIKESLELM QYLPQHTIETYRRVIDAVRFTLRQTISFPPRD EWNDFNFDMDARRNKQQRIKEEGE BLAST tegen PDB SPAIPSNTDYPGPHSFDVSFQQSSTAKSATW EFLKSSRLTVDS---VDAKATPF GAVIRAMPVYKKAEHVTEVVKRCPNHELSRE ALKMRAMP-----EFLCMNWLNSDDMELS-- Onbekende structuur Gemodelleerde structuur Homologe structuur Gebruik de homologe structuur om de onbekende structuur te modeleren

5 Model! 1: Template recognition and initial alignment 2: Alignment correction 3: Backbone generation 4: Loop modeling 5: Sidechain modeling 6: Model optimization 7: Model validation Homology Modeling: “Prediction of structure based upon a highly similar structure” 8: Iteration

6 En dan begint het pas echt….want met een structuur kun je: De werkelijkheid verklaren: Mutant-analyse Ligand interacties Complexvorming Experimenteel design Nieuwe voorspellingen doen

7 Veel verschillende projecten: AfdelingeiwitActie CelbiologieEGF-receptorenModeleren, Ligand bindings-studie Organische chemieCalBOpzetten experiment Eukaryote Microbiologie, GroningenPyruvaat carboxylaseModeleren, opzetten hypothesis Klinische ChemieHFE, HepcidineMutatie studie, modeleren Membraan BiochemieAquaporineInteractie studie Membraan BiochemieTrpm6Modeleren, mutant en interactie studie AntropogeneticaCatechol methyltransferaseModeleren, mutant studie AntropogeneticaEstrogen receptorModeleren, mutant studie Biomoleculaire chemieAlcamModeleren, interaction studie en suggesties voor experiment Immunologie, UMC UtrechtFcReceptorsModeleren, opzetten hypothese en experiment Interne geneeskundeDectinModeleren, mutant studie Centrale HematologieFactor VIIIModeleren, mutant studie Gasteroenterologie & HepatologiePRKCSH, SEC63Modeleren, mutant studie Centrum voor Mitochondriele ziektenComplex 1Modeleren, suggesties experiment  Zie ook:

8 Voorbeeld: Mutanten in de estrogen-receptor, leiden tot doofheid Afdeling:Antropogenetica V133L L138P L111P Geaccepteerd in American Journal of Human Genetics TKIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSS LSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRA ILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELS QRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEA

9 L183P TfR1 β2M HFE TfR1 - L183 P183 Voorbeeld: Mutanten in HFE protein leiden tot erfelijke ijzerstapelingsziekten Afdeling: Klinische Chemie Geaccepteerd in Blood, Cells, Molecules and Disease

10 Voorbeeld: C-terminale deletie van 10 aa in Dectine Afdeling: Interne geneeskunde of Internal Medicine >Dectin_1_Isoform_a MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVS EKGSCAASPPWRLIAVILGILCLVILVIAVVL GTMAIWRSNSGSNTLENGYFLSRNKENHSQPT QSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYE KSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDS SNELGFIVKQVSSQPDNSFWIGLSRPQTEVPW LWEDGSTFSSNLFQIRTTATQENPSPNCVWIH VSVIYDQLCSVPSYSICEKKFSM

11 Iets heel anders…..experimental design voor Organische chemie  Aanbrengen van een Palladium-atoom in Cal B voor verder onderzoek (AHA)CalB Waar?

12

13

14 4 mutanten om uit te proberen: V221 V149 L147 L219

15

16 Voorbeeld: Suggestie voor mutanten die de Alcam-dimeer verstoren Afdeling: Biomoleculaire Chemie

17 ATOM 1 N GLN A N ATOM 2 CA GLN A C ATOM 3 C GLN A C ATOM 4 O GLN A O ATOM 5 CB GLN A C ATOM 6 CG GLN A C ATOM 7 CD GLN A C ATOM 8 OE1 GLN A O ATOM 9 NE2 GLN A N ATOM 10 N SER A N ATOM 11 CA SER A C ATOM 12 C SER A C ATOM 13 O SER A O ATOM 14 CB SER A C ATOM 15 OG SER A O ATOM 16 N CYS A N ATOM 17 CA CYS A C ATOM 18 C CYS A C ATOM 19 O CYS A O ATOM 20 CB CYS A C ATOM 21 SG CYS A S ATOM 22 N LEU A N Translational science: van lab naar PC en weer terug…. MAEKGDCIASVYGYDLGGRFVDFQ PLGFGVNGLVLSAVDSRACRKVAV KKIALSDARSMKHALREIKIIRRL DHDNIVKVYEVLGPKGTDLQGELF KFSVAYIVQEYMETDLARLLEQGT LAEEHAKLFMYQLLRGLKYIHSAN VLHRDLPANIFISTEDLVLKIGDF GLARIVDQHYSHKGYLSEGLVTKW YRSPRLLLSPNNYTKAIDMWAAGC ILAEMLTGRMLFAGAHELEQMQLL ETIPVIREEDKDELLRVMPSFVSS TWEVKRPLRKLLPEVN ? Lab Bioinformatics Translation

18 Zonder structuur toch een antwoord… Transmembraan voorspelling L  Q E  R -Verstoring helix interacties in membraan -Verstoring verankering in membraan

19 Secondaire structuur voorspelling Zonder structuur toch een antwoord… L naar P in helix

20 Zonder structuur toch een antwoord… Gebruik helical wheel: A->S Patronen zoeken: G-X-G(A)-X-X-G = ATP binding motif Algemene kennis: P  X, G  X etc.

21 Simpele weergave van eiwitten kan, maar voor meer details is echt een 3D-structuur nodig 3D-structuren haal je uit de PDB of maak je jezelf met Homology Modeling Met een structuur kun je de realiteit verklaren maar ook nieuwe voorspellingen doen en experimenten opzetten Zelfs zonder structuur is er soms nog wel iets te zeggen over mutanten door andere servers en algemen kennis te gebruiken In veel verschillende onderzoeksgebieden kunnen structuren een uitkomst bieden, overal kom je eiwitten tegen…. Conclusie


Download ppt "Homology Modeling in de praktijk. Voor de medicus/bioloog…. of zelfs…. 4 niveau’s voor visualisatie…. MSASTQTNEFLSPEVFQHIWDFLEQPICSVQ PIDLNFVDEPSEDGATNKIEISMDCIRMQDS."

Verwante presentaties


Ads door Google